PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G212100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TALE
Protein Properties Length: 330aa    MW: 36818.7 Da    PI: 6.744
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G212100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.5e-092552892155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Prupe.3G212100.1.p 255 KWPYPSEAQKLALAESTGLDLKQINNWFINQRKRH 289
                         569*****************************885 PP

2ELK29.51.7e-10209230122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         E+K  Ll+KY gyLgsLkqEF+
  Prupe.3G212100.1.p 209 EIKAKLLHKYTGYLGSLKQEFM 230
                         8999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.7E-1668112IPR005540KNOX1
PfamPF037903.8E-1970108IPR005540KNOX1
SMARTSM012564.8E-23118169IPR005541KNOX2
PfamPF037914.5E-21125168IPR005541KNOX2
SMARTSM011881.2E-5209230IPR005539ELK domain
PROSITE profilePS5121310.214209229IPR005539ELK domain
PfamPF037892.6E-6209230IPR005539ELK domain
PROSITE profilePS5007111.904229292IPR001356Homeobox domain
SuperFamilySSF466891.71E-19231307IPR009057Homeodomain-like
SMARTSM003892.4E-11231296IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-27234293IPR009057Homeodomain-like
CDDcd000862.22E-12241293No hitNo description
PfamPF059205.6E-17249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MERGGTNCNN SSGVTYSGLM MGFGNNTGRT GSSKAQFLSL PLMVGCSHPN LQSDHQTTDQ  60
EMMVSCSDRM EAKIMAHPLF PRLLASYVSC QKVGAPPEVV ARLEQACSAA VHNSEAACLG  120
GGDPDPALDQ FMEAYCEMLT KYEEELTKPF KEAMLFLSKI DSQLQALTVH SSSDSASSGD  180
NIVGRSGSPE EVDATMNESC IDPRAEDREI KAKLLHKYTG YLGSLKQEFM KKKKNGKLPK  240
EARHQLLDWW SRHYKWPYPS EAQKLALAES TGLDLKQINN WFINQRKRHW KPSEDIQFAV  300
MDPTHPHHHP HFYMDNNLTF PMNSTSTLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2817740.0GQ281774.1 Prunus persica class I KNOX homeobox transcription factor STM-like 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230002.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-112HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE80.0D3IWE8_PRUPE; Class I KNOX homeobox transcription factor STM-like 1
STRINGVIT_12s0059g01190.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-109KNOX/ELK homeobox transcription factor